PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5AS_4B8974198.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 260aa    MW: 28405.6 Da    PI: 4.8717
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5AS_4B8974198.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR170.93e-22127247390
                   FAR1   3 YneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkk..................................tekerrtra 56 
                            Yn+Y+ ++GFs+++++s+k  ++ge +k++fvC+k  k++ ++                                    ++k+r++ +
  Traes_5AS_4B8974198.2 127 YNAYSLQMGFSIKMNSSRKDLKTGELIKQQFVCNKFRKPDVDDGGaekipvlddiveqekndnedeaivfldddskgkkRSKKRKRDK 214
                            ***********************************999999888899******************************98889999999 PP

                   FAR1  57 etrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                              +tgCkak+ vk   dg+wev+ +++eHnH+l+
  Traes_5AS_4B8974198.2 215 IVQTGCKAKMIVKVI-DGRWEVIYFVSEHNHPLV 247
                            ***************.****************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.3E-20127247IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MIDLNEVPAE NNDDPLYCTQ HGSGNAEFVA ESPNPPIIQR VDGAATEAME ADGKSSHGGR  60
APGSTQVPAA IATGDAHTLD GTGAAGDTGG TVGNGLGAEN DDEAWSQPKE PYVGMRFDTL  120
EDAKVHYNAY SLQMGFSIKM NSSRKDLKTG ELIKQQFVCN KFRKPDVDDG GAEKIPVLDD  180
IVEQEKNDNE DEAIVFLDDD SKGKKRSKKR KRDKIVQTGC KAKMIVKVID GRWEVIYFVS  240
EHNHPLVDKP CLTKYLQSHQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLW5F4I80.0W5F4I8_WHEAT; Uncharacterized protein
STRINGMLOC_28634.11e-127(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP9528843
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G07500.11e-11FAR1 family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]